Protein Info for Pf1N1B4_4983 in Pseudomonas fluorescens FW300-N1B4

Annotation: Polyhydroxyalkanoic acid synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 585 PF07167: PhaC_N" amino acids 95 to 264 (170 residues), 197.3 bits, see alignment E=1.7e-62 PF00561: Abhydrolase_1" amino acids 260 to 510 (251 residues), 53.2 bits, see alignment E=3.4e-18

Best Hits

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 49% identity to pla:Plav_1129)

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161XE59 at UniProt or InterPro

Protein Sequence (585 amino acids)

>Pf1N1B4_4983 Polyhydroxyalkanoic acid synthase (Pseudomonas fluorescens FW300-N1B4)
MNKTPRIARSTDTPAKRRRAPKALQEQQKQELAVKTAQVATPLLRVRPVDLLSASGSLFK
AVGKTPVKAARHVGSFFKELGNIVAGSSSVAPNPKDKRFCDPAWQSNALLRGLLQSYLAG
NDELSRFIEEAHLDARDKGRARFIAAQLFDALAPSNLLLTNPAALRKLLDTGGMSLVKGI
GQFSRDLRHNGGMPMQVDSAPFKVGENVATAKGEVVLRTEMFELLQFAPTTKNVHARPLV
MSPPQINKYYAIDLSPDKSLIKWIQDSGIQLFVVSWRNPTSMHRDWGLSEYALCLDQAVD
VARQITGSADVNMWGSCSGGLTLAAYLGWLAARGEGAKVANTSWAVCVLDMPALFGETAI
GLFATPAVLRAAKTSSHCKGTLSGQDIARMFAWMRPNDLIWNYWVNNYLLGNKPPAFDIL
AWNNDSTRLPAKLHADYLDLAQHNPYSNPGVLQIAGESIDMSKIKVGAYVIGGTTDHITP
WQGCYGTARLFGEDSTFVLSNAGHLQSLINPPGNPKSYFYAAAATASDPESWLQDAGESH
TGSWWPHWRQWIEQRSGASRPAPRKLGSRKYPPLYAAPGHYVLER