Protein Info for Pf1N1B4_4979 in Pseudomonas fluorescens FW300-N1B4

Annotation: Transcriptional regulator, AsnC family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF13404: HTH_AsnC-type" amino acids 11 to 52 (42 residues), 57.8 bits, see alignment E=1.1e-19 PF13412: HTH_24" amino acids 11 to 58 (48 residues), 70.9 bits, see alignment E=7.9e-24 PF01037: AsnC_trans_reg" amino acids 80 to 151 (72 residues), 69.9 bits, see alignment E=2e-23

Best Hits

Swiss-Prot: 40% identical to BKDR_PSEPU: Bkd operon transcriptional regulator (bkdR) from Pseudomonas putida

KEGG orthology group: None (inferred from 83% identity to pba:PSEBR_a2904)

Predicted SEED Role

"Transcriptional regulator, AsnC family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QD19 at UniProt or InterPro

Protein Sequence (166 amino acids)

>Pf1N1B4_4979 Transcriptional regulator, AsnC family (Pseudomonas fluorescens FW300-N1B4)
MKKKITHRAVLDDTDLSILALLQEDASISNAELSERLSLSLTPCWRRRKRLEEEGVIKDY
QANLDRRKLGLDIMAFVHIRFATHTDHTPEAFEAVIMQLPEVLSCHKITGDADYLLQVLA
QDLDSYSDFVESVLRRQLGIASIQSSLALREVKTTSRIAIPGRTKQ