Protein Info for Pf1N1B4_4974 in Pseudomonas fluorescens FW300-N1B4

Annotation: Protease subunit of ATP-dependent Clp proteases

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 185 PF00574: CLP_protease" amino acids 25 to 168 (144 residues), 44.8 bits, see alignment E=6.7e-16

Best Hits

KEGG orthology group: None (inferred from 85% identity to pfl:PFL_4739)

Predicted SEED Role

"Protease subunit of ATP-dependent Clp proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161XE48 at UniProt or InterPro

Protein Sequence (185 amino acids)

>Pf1N1B4_4974 Protease subunit of ATP-dependent Clp proteases (Pseudomonas fluorescens FW300-N1B4)
MTEHIVHFHCQIDQGTMERFRDCCLDAIDQGASSLLLNLSTSGGSTNFGFALYTFLKSLP
VPLCAINAGNIESMGIIMYLAAGRRITAPHSRFLIHPMNWYFSQSSVDHQRLREYLSSLD
NDLARYVQIFALETAHADTKLDIFHCLSAEEKVIAAHESLAYGIAHEMHQMVFADNVKHW
KISGG