Protein Info for Pf1N1B4_4934 in Pseudomonas fluorescens FW300-N1B4

Updated annotation (from data): DNA damage response nuclease
Rationale: Conserved and specific phenotype: important for resisting cisplatin. Contains a VRR-NUC domain that is predicted to have nuclease activity.
Original annotation: Hypothetical protein, restriction endonuclease-like VRR-NUC domain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 transmembrane" amino acids 389 to 389 (1 residues), see Phobius details PF21315: FAN1_HTH" amino acids 10 to 91 (82 residues), 119.9 bits, see alignment E=5e-39 PF18081: FANC_SAP" amino acids 95 to 145 (51 residues), 51.9 bits, see alignment 1.1e-17 PF08774: VRR_NUC" amino acids 434 to 545 (112 residues), 127.3 bits, see alignment E=4.8e-41

Best Hits

Swiss-Prot: 57% identical to FAN1_PSEAE: Fanconi-associated nuclease 1 homolog (fan1) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 80% identity to pfo:Pfl01_2689)

Predicted SEED Role

"Hypothetical protein, restriction endonuclease-like VRR-NUC domain"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QBW3 at UniProt or InterPro

Protein Sequence (550 amino acids)

>Pf1N1B4_4934 DNA damage response nuclease (Pseudomonas fluorescens FW300-N1B4)
VIVNPLDDPFYYLNNFMQVLDWLEHRYADVLSLEEQDFIRDFNRLPRESQALLVRLVMRK
GVHFRAGKLSYVEIGDIDSAAAPLLVSGWIDEQSPLHIEDLFEVLLKAEILQCIGSAIDQ
PKGKKTDWLPVLSEQFPEAQSFAQWCPALNERLFSLTVMDLCDRLRLMFFGNLYQDWSEF
VLADLGIFTYEKVEFCTESRGLRSREDVDACLFLHSCQQRFEAGEDVAAIVEQINGLELG
NPWLQRRRGKLLFQIGQHCERVADFSTALNLYRECAYPGARLRLIRVLERCAEYQLAMNL
ATHAEQAPESAAEHQHLSRVLPRLRRKLGGPPIKRPAPRAMQRLDLQLPRHDPTLSVESY
VQAHLADDSAPVHYVENSLINSLFGLLCWPAIFAPLPGAFFHPFQRGPVDLLNEDFHARR
ADLFQACLAELDDGRYVQTVRERYSAKWGVQSPFVFWGALSEELLEQALACLPAEHLKHW
FNRLLLDIKANRAGMPDLIQFWPQHKTYRMIEVKGPGDRLQDNQLRWLEFCHEHQMPIAV
CYVQWAEQGA