Protein Info for Pf1N1B4_4926 in Pseudomonas fluorescens FW300-N1B4

Annotation: ATPase components of various ABC-type transport systems, contain duplicated ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 613 PF00005: ABC_tran" amino acids 24 to 183 (160 residues), 79.6 bits, see alignment E=1.3e-25 amino acids 300 to 451 (152 residues), 103.1 bits, see alignment E=7.3e-33 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 503 to 591 (89 residues), 43.6 bits, see alignment E=3.6e-15 PF08352: oligo_HPY" amino acids 506 to 570 (65 residues), 37.5 bits, see alignment E=8.8e-13

Best Hits

KEGG orthology group: None (inferred from 93% identity to pba:PSEBR_a3501)

Predicted SEED Role

"ATPase components of various ABC-type transport systems, contain duplicated ATPase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QBP7 at UniProt or InterPro

Protein Sequence (613 amino acids)

>Pf1N1B4_4926 ATPase components of various ABC-type transport systems, contain duplicated ATPase (Pseudomonas fluorescens FW300-N1B4)
MSDLIRVEDLRVVACGERGEVEIVKGVSFSLAKGEVLALIGESGSGKTTIALALLGYARR
GCRLAGGVVQVGEHDMLALSESELQGLRGNRVSYIAQSAAAAFNPAKKLIDQVVEGALIH
GLGSRAVLEAKAIELFRDLALPDPDHIGQRYPHQVSGGQLQRVMAAMALISDPLLVVLDE
PTTALDVTTQIDVLRAFKRVVRERGATAVYVSHDLAVVAQMADQIVVLNGGQIFEQSATA
PLLKAPTHEYTRSLLLAARPDTTIRPPCGIAEETPLLTIQGLTAGYGNKNMQGMPAIRVL
EDIDLTVRRGQAIGVIGESGSGKSTLARVVAGLLTPALGGLTFDGQPLGGSLSERTDEQF
RRIQMVFQNADTALNPMHSVGTILSRPLKMYFGLKGVALRERIGELLDLVRLPRAMAERR
PNELSGGQKQRVNLARALAAKPDLILCDEVTSALDTVVGAAILELLRDLRQQLGVSYLFI
SHDISTVRALCDDIVVMYSGHKVQAGARQSFAQAPFHPYTDLLIHSVPELRQGWLENCGT
TCGTLPPIGAKANVPELCTFLSRCPVRVDGLCNRTAPNRRIIDGGSEILCHHDSAELLKT
QRDLTTMSLGAYA