Protein Info for Pf1N1B4_4886 in Pseudomonas fluorescens FW300-N1B4

Annotation: Phosphoglucomutase (EC 5.4.2.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01132: phosphoglucomutase, alpha-D-glucose phosphate-specific
  • amino acids 1 to 545 (545 residues), 876.2 bits, E=3.7e-268
• PF02878: PGM_PMM_I
  • amino acids 40 to 180 (141 residues), 106.3 bits, E=2.1e-34
• PF02879: PGM_PMM_II
  • amino acids 211 to 318 (108 residues), 47.5 bits, E=4.6e-16
• PF02880: PGM_PMM_III
  • amino acids 323 to 440 (118 residues), 97.9 bits, E=8.2e-32
• PF00408: PGM_PMM_IV
  • amino acids 493 to 538 (46 residues), 32.3 bits, 1.7e-11

Best Hits

Swiss-Prot: 64% identical to PGM_KOMXY: Phosphoglucomutase (celB) from Komagataeibacter xylinus

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] (inferred from 96% identity to pfo:Pfl01_2670)

MetaCyc: 63% identical to phosphoglucomutase (Mycobacterium tuberculosis H37Rv)
Phosphoglucomutase. [EC: 5.4.2.2]

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• glycogen degradation II (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glucose and glucose-1-phosphate degradation (4/5 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose biosynthesis II (6/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (3/4 steps found)
• starch degradation V (3/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• starch degradation III (2/4 steps found)
• chitin biosynthesis (5/9 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• starch biosynthesis (5/10 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (3/8 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• streptomycin biosynthesis (3/18 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.2

Use Curated BLAST to search for 5.4.2.2

Sequence Analysis Tools

See A0A162B0H2 at UniProt or InterPro

Protein Sequence (548 amino acids)

>Pf1N1B4_4886 Phosphoglucomutase (EC 5.4.2.2) (Pseudomonas fluorescens FW300-N1B4)
MTLSPFAGKPAPAELLVDIPRLVTAYYTGQPDAAISTQRVAFGTSGHRGSSFDLSFNEWH
VLAISQAICLYREAQGIDGPLFVGIDTHALSTPAGASALEVLAANGVTVMIAEGDEYTPT
PAISHAILCYNRGRTSGLADGIVITPSHNPPQSGGYKYNPTNGGPADTHITKWIEAKANE
LLAAKLAGVKRISYEQALKASTTHRHDYLNTYVADLINVIDFDAIREAKLRLGVDPLGGA
GVRYWSAIAEHYRLDLEVVNKQVDATFRFMTVDWDGQIRMDPSSSHAMQGLIGLKERFDV
AFACDPDHDRHGIVTPSGGLLAPNNYLAVSIDYLFQNRPLWRADAAVGKTVVSSGLIDRV
AKRLGRRLYEVPVGFKWFADGLFDGSLGFGGEESAGASFLRKDGSVWCTDKDGLIPALLA
AEMTARTGRDPSQAYRALTDELGEPFSVRVDAKANPEQKALLSKLSPDQVTSTQLAGEAI
QSILSHAPGNDQAIGGLKVMTENGWFAARPSGTEDIYKIYAESFVSDDHLKQLVAEAQTL
VDGAISAK