Protein Info for Pf1N1B4_4870 in Pseudomonas fluorescens FW300-N1B4

Annotation: Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 5 to 58 (54 residues), 35.8 bits, E=6.5e-13
• PF01799: Fer2_2
  • amino acids 72 to 149 (78 residues), 90.1 bits, E=7.9e-30

Best Hits

Swiss-Prot: 51% identical to IORA_BREDI: Isoquinoline 1-oxidoreductase subunit alpha (iorA) from Brevundimonas diminuta

KEGG orthology group: K07302, isoquinoline 1-oxidoreductase, alpha subunit [EC: 1.3.99.16] (inferred from 97% identity to pba:PSEBR_a2855)

MetaCyc: 60% identical to 2-deoxy-D-ribose dehydrogenase alpha subunit (Pseudomonas simiae)
1.1.2.M2 [EC: 1.1.2.M2]

Predicted SEED Role

"Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16)" in subsystem N-heterocyclic aromatic compound degradation (EC 1.3.99.16)

MetaCyc Pathways

• 2-deoxy-D-ribose degradation II (4/8 steps found)

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.16

Use Curated BLAST to search for 1.1.2.M2 or 1.3.99.16

Sequence Analysis Tools

See A0A166QAP7 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Pf1N1B4_4870 Isoquinoline 1-oxidoreductase alpha subunit (EC 1.3.99.16) (Pseudomonas fluorescens FW300-N1B4)
MSALNINGRDYTVDVDPGTPILWTLRDALGMTGTKFGCGAALCGACTVHLDGQAIRSCVT
PIAAAEGRKITTIEAATNGSDPVGTAVHEAWVKHDVAQCGYCQSGQIMSATAFLKAQPKG
KQPTAAEIDSAMAGNICRCGTYARIRAAVADAAKALA