Protein Info for Pf1N1B4_4860 in Pseudomonas fluorescens FW300-N1B4

Annotation: Sensory box sensor histidine kinase/response regulator (EC 2.7.3.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 PF00512: HisKA" amino acids 181 to 246 (66 residues), 38.3 bits, see alignment E=1.7e-13 PF02518: HATPase_c" amino acids 289 to 409 (121 residues), 71.4 bits, see alignment E=1.3e-23 PF00072: Response_reg" amino acids 434 to 545 (112 residues), 64 bits, see alignment E=2e-21

Best Hits

KEGG orthology group: None (inferred from 86% identity to pba:PSEBR_a3077)

Predicted SEED Role

"Sensory box sensor histidine kinase/response regulator (EC 2.7.3.-)" (EC 2.7.3.-)

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162B0F4 at UniProt or InterPro

Protein Sequence (550 amino acids)

>Pf1N1B4_4860 Sensory box sensor histidine kinase/response regulator (EC 2.7.3.-) (Pseudomonas fluorescens FW300-N1B4)
MSERAIILAPLGRDSQIALMMLNEAGFDGVITRDLGALCNELSLGAGLLVISSEALLGAD
LEPLLGLIEQQPAWSDLPIVLLTHHGGPEQNPASRLGSQLGNVTFLERPFHPVTLISLVT
TALRGRRRQYEARDRLIDLSQSELRLQNTLETLEQQVEERTAQLRLNEEVLRQSQKMEAV
GQLTGGIAHDFNNMLTGIIGSLELLRRRLARGRTEDLDSLIDLGVTSANRAAGLTHRLLA
FSRRQSLDSKPVQMNTLVVSMGELLLRSINESIHLEMQLDEQLWVAEADPNQLESALLNL
VLNARDAMPDGGKLLVKTSNQHLDTGFTAAHSNLQPGDYIVLSVTDTGYGMPQSTINRAF
DPFFTTKPIGQGTGLGLSMIYGFSKQSGGHASIHSEVGKGTTVSLFLPRFSGELVQDTQI
DAQHAPYARDGETVLIVEDDPAVRVLVSAVLSELGYAFVEACDADSAVPILDSGQRIDLL
ISDVGLPGMNGRQLAEIGRQYRPDLKVLFITGYAEHAAVRGGFLDPGMQMITKPFTFDLL
TAKVREMIRI