Protein Info for Pf1N1B4_485 in Pseudomonas fluorescens FW300-N1B4

Annotation: L-lysine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 65 (21 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details PF01810: LysE" amino acids 1 to 182 (182 residues), 105.6 bits, see alignment E=1.2e-34

Best Hits

KEGG orthology group: None (inferred from 89% identity to pfo:Pfl01_4189)

Predicted SEED Role

"L-lysine permease" in subsystem Lysine degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>Pf1N1B4_485 L-lysine permease (Pseudomonas fluorescens FW300-N1B4)
VTIRQSVRFGRLVGICTALGIGAGISVHVLYTLLGVGALMHTTPWLLTVAKVVGGAYILY
LGVSLIRSKPKSAIEGDKGAETSAERQTLFKAFSTGFLTNATNPKATLFFLAIFTTIISA
TTPLQIQALYGLWMCFVNALWFVIVALFFSSARVRLLFMRMGHWFERTMGVILILFAGRL
ILSM