Protein Info for Pf1N1B4_4835 in Pseudomonas fluorescens FW300-N1B4

Annotation: Carbon starvation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 685 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 92 to 112 (21 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 160 to 183 (24 residues), see Phobius details amino acids 191 to 209 (19 residues), see Phobius details amino acids 221 to 241 (21 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 363 to 385 (23 residues), see Phobius details amino acids 465 to 484 (20 residues), see Phobius details amino acids 510 to 529 (20 residues), see Phobius details amino acids 542 to 566 (25 residues), see Phobius details amino acids 573 to 595 (23 residues), see Phobius details amino acids 644 to 666 (23 residues), see Phobius details PF02554: CstA" amino acids 32 to 408 (377 residues), 580.9 bits, see alignment E=1e-178 PF13722: CstA_5TM" amino acids 463 to 591 (129 residues), 142.3 bits, see alignment E=9.5e-46

Best Hits

Swiss-Prot: 71% identical to CSTA_ECOLI: Peptide transporter CstA (cstA) from Escherichia coli (strain K12)

KEGG orthology group: K06200, carbon starvation protein (inferred from 94% identity to pfs:PFLU5333)

MetaCyc: 71% identical to pyruvate transporter CstA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-335

Predicted SEED Role

"Carbon starvation protein A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q9W2 at UniProt or InterPro

Protein Sequence (685 amino acids)

>Pf1N1B4_4835 Carbon starvation protein A (Pseudomonas fluorescens FW300-N1B4)
MPRLAKHLAWFAVAVLGAFALSVVALRRGEAINALWIVVAAVAIYLVAYRYYSLFIATKV
MQLDPNRATPAVLNNDGLDYVPTNKHVLFGHHFAAIAGAGPLVGPVLAAQMGYLPGTLWL
IAGVVLAGAVQDFMVLFMSTRRNGRSLGDMVREEMGRIPGTIALFGCFLIMIIILAVLAL
IVVKALAESPWGMFTVMATIPIAMFMGIYMRYIRPGRIGEISVIGVALLLGSIWLGGQIA
ADPVWAKAFTFTGIQITWMLIGYGFVAAVLPVWLILAPRDYLSTFLKIGTIVALAIGILI
TMPDLKMPALTQFIDGTGPVWKGGLFPFLFITIACGAVSGFHSLIASGTTPKLLASEGHA
RYIGYGGMLMESFVAIMAMVAASVIEPGVYFAMNSPAALVGADAVSVAQTVSSWGFAITP
EALQAVAKDIGEATILARAGGAPTLAVGIAQILHQLLPGENTMAFWYHFAILFEALFILT
AVDAGTRAGRFMLQDLLGSFVPALKRTESWTANLIATAGCVAMWGYLLYQGVIDPLGGIN
TLWPLFGISNQMLAGIALMLATVVLIKMKRQRYVWVTMLPAVWLLICTTTAGFIKLFDAN
PAIGFLALAKKYSDALANGQVLAPAKSIEQMQHVIYNAYTNATLTALFLLVVFSILFFAL
KVGIAAWGTKERTDKEAPFQALPDA