Protein Info for Pf1N1B4_4831 in Pseudomonas fluorescens FW300-N1B4

Annotation: Outer membrane protein assembly factor YaeT precursor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 489 TIGR01845: efflux transporter, outer membrane factor (OMF) lipoprotein, NodT family" amino acids 8 to 448 (441 residues), 288.8 bits, see alignment E=3.8e-90 PF02321: OEP" amino acids 48 to 238 (191 residues), 83.2 bits, see alignment E=1.1e-27 amino acids 262 to 446 (185 residues), 78.9 bits, see alignment E=2.3e-26

Best Hits

KEGG orthology group: None (inferred from 80% identity to pfo:Pfl01_2139)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (489 amino acids)

>Pf1N1B4_4831 Outer membrane protein assembly factor YaeT precursor (Pseudomonas fluorescens FW300-N1B4)
LRPSGAGFSAPGEAWTKLWSSPALEQASQRSLNPDIRQWWQVFADPVLDALIAESDAHNS
NLKIAGLRVMEARARLGIAQSGRYPQLQQASADSLYFNRKQSGGNNPQDSHFWQHSAGFD
VGWELDFWGRFSRAIESSDASYFAAQANYEDVLVLLRAQVADTYFSLRTTEARLRVAREN
AEQQKRNFEITEKLFNSGQSAELDVQQAKTQYLGTLSSIPDFEAQVVRTRNALAVLIGQP
PSALPQLLEHEGLIPLVDRAVLQDVPANLLLRRPDVRAAELNVAAQSALIGVAQTDFYPS
LTLLGSIVWTTDTLSGTSNSLDLIGGPSLRWNLFDHGQISNNVRIQDARLQQLIEVYREK
VRQAAREADDAASSLIKSLERERILGEAQVAAARSLSLANTQYREGYSDFQRVLDAQRAL
LEQQDNYLLSRSNAVSNLIALYKALGGGWYSAQPTVDQNTRQQMEQRTDWGNLLNEPAPS
QASYPEPEG