Protein Info for Pf1N1B4_4829 in Pseudomonas fluorescens FW300-N1B4

Annotation: Membrane protein, putative

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 61 (19 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 111 (20 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details amino acids 165 to 191 (27 residues), see Phobius details amino acids 212 to 230 (19 residues), see Phobius details amino acids 232 to 233 (2 residues), see Phobius details amino acids 236 to 254 (19 residues), see Phobius details amino acids 265 to 283 (19 residues), see Phobius details amino acids 295 to 316 (22 residues), see Phobius details PF11168: DUF2955" amino acids 3 to 134 (132 residues), 92.5 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: None (inferred from 72% identity to pfo:Pfl01_2137)

Predicted SEED Role

"Membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z8D0 at UniProt or InterPro

Protein Sequence (330 amino acids)

>Pf1N1B4_4829 Membrane protein, putative (Pseudomonas fluorescens FW300-N1B4)
MGTGTALCLAASFGLGLPIPFLAPVLAVLLLASLNRPLPLKAGLILALAAMLTTGVGLLL
IPILRYYPITGVLLIGVSMFLAFGFGLRGGNALIMTFMIIGLTMISSAGVAEFDLAMMVI
GALVKGLILAVLVVGISHWLFPDPANAPSPPAASALPEQEVGRVALRATLIVIPAFLLAL
IDPASYLPIILKAVSLGQQSSTTTTRNAAHELLGSTFMGGLLAVGFWCALSLFVHLWMFF
LWMLLFGLLLARKLYALSPTRQTPGFWLNSLVTLIILLGQSVQDSLAGKDVYTAFAVRMG
LFIALTLYACLMVYLLDQRRRNPGVSQPDH