Protein Info for Pf1N1B4_4799 in Pseudomonas fluorescens FW300-N1B4

Annotation: Multidrug resistance protein B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 74 to 91 (18 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 208 to 229 (22 residues), see Phobius details amino acids 246 to 263 (18 residues), see Phobius details amino acids 274 to 292 (19 residues), see Phobius details amino acids 298 to 322 (25 residues), see Phobius details amino acids 336 to 358 (23 residues), see Phobius details amino acids 364 to 383 (20 residues), see Phobius details PF07690: MFS_1" amino acids 11 to 350 (340 residues), 145.6 bits, see alignment E=1.9e-46 PF12832: MFS_1_like" amino acids 25 to 367 (343 residues), 45.7 bits, see alignment E=5.1e-16

Best Hits

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a2200)

Predicted SEED Role

"Multidrug resistance protein B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q906 at UniProt or InterPro

Protein Sequence (392 amino acids)

>Pf1N1B4_4799 Multidrug resistance protein B (Pseudomonas fluorescens FW300-N1B4)
VATYSLVIRRLMIVSLTIVVSRAITSPLLTLFLSNKLGLNQQDVGLLLGIAVFIATLLAL
YGGYIIDRLEKRRLLILTMLSSAIGFVLLTFAENLYLTTATLVITETASALFLIGSKAIL
SENLPVGQRAKAFSLRYTLTNIGYATGPMLGVVIAGVQPLAPFLIAGGIAFFSIFLMSGI
PKDPAQTPAIGQPQSFLKTLITLKNDRTLIMFTCGCLLSTVVHGRFTLYLSQYLLVTQDT
KRALETMAALLACNAISVILLQYQIGRFLKREQLRYWIAGGTSLFILGLIGFSLADSLVS
WCVAMFIFTLGEMIIYPAEFLFVDTLAPEELRGSYYGAQNLAALGGALSPVICGYLLLHT
PAPTMFYALSALTAMGGLLCFMSGRRVAILQK