Protein Info for Pf1N1B4_4792 in Pseudomonas fluorescens FW300-N1B4

Annotation: Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 28 to 50 (23 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 105 to 122 (18 residues), see Phobius details amino acids 167 to 186 (20 residues), see Phobius details amino acids 206 to 225 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 20 to 127 (108 residues), 67 bits, see alignment E=9e-23 PF00528: BPD_transp_1" amino acids 44 to 232 (189 residues), 84.8 bits, see alignment E=3.4e-28

Best Hits

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (371 amino acids)

>Pf1N1B4_4792 Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1) (Pseudomonas fluorescens FW300-N1B4)
VNSFLNLIGVDLSSLQGYGPLLLHGTWVTLKLSALSLLVSMALGLLGAAAKLSPLKLLNL
PATFYTTLIRGVPDLVLMLLIFYSLQGWLSSLTEAMDWPYMEIDPFVAGVVTLGFIYGAY
FTETFRGAILSVPRGQQEAAASFGLNRWQRFRFVVFPQMMRFALPSLGNNWLVLLKATAL
VSIIGLSDLVKVAQEAGKSTFNMLDFLLLAGALYLLITSASNYVLRVLERRYNQGVRGWR
DDRVDCRILEALSVQRRLQPHRIGDDFVAVGGEHRDGVLPVVAIGDHAHFALGPAALAGS
AVYLCVSWHAAVYPVADLLQRDLRHRRGPLATAARSVLSRCDELHLAGVHAQHLRLHRGN
LRRGDSQHSLR