Protein Info for Pf1N1B4_4791 in Pseudomonas fluorescens FW300-N1B4

Annotation: Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 259 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF00497: SBP_bac_3" amino acids 28 to 252 (225 residues), 194.9 bits, see alignment E=1.3e-61 PF09084: NMT1" amino acids 111 to 181 (71 residues), 21.8 bits, see alignment E=1.6e-08

Best Hits

KEGG orthology group: K02030, polar amino acid transport system substrate-binding protein (inferred from 87% identity to pfl:PFL_3061)

Predicted SEED Role

"Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161ZDC4 at UniProt or InterPro

Protein Sequence (259 amino acids)

>Pf1N1B4_4791 Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1) (Pseudomonas fluorescens FW300-N1B4)
MNIKWLTLPALALLCCSTGASAKEWKELRFGVNPSYPPFESTTADGGVQGFGVDLGNAIC
AELKLKCVWVSNDFDGLIPALKAGKFDAIESSMTVTDARKKQIDFTDRLYAGPTAIVTRK
DSGLLPTAESLRGKTIGYMQGTIQETYAKAKLGPGGVKLRAYQNQDQVYADLVFGRLDAS
IQDKLQAQMSFLTSPQGADFQNSEGISDPLVPSEIAIGIRKDNEELKGMLNAAIKALHEK
GIYAQIQQKHFGDLDLYNN