Protein Info for Pf1N1B4_4788 in Pseudomonas fluorescens FW300-N1B4

Annotation: Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00378: ECH_1
  • amino acids 11 to 256 (246 residues), 266.8 bits, E=1.7e-83
• PF16113: ECH_2
  • amino acids 14 to 185 (172 residues), 124.1 bits, E=9.2e-40

Best Hits

Swiss-Prot: 67% identical to ECHH_RHIME: Probable enoyl-CoA hydratase (fadB1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01692, enoyl-CoA hydratase [EC: 4.2.1.17] (inferred from 91% identity to pfo:Pfl01_2866)

MetaCyc: 61% identical to acryloyl-CoA hydratase (Ruegeria pomeroyi DSS-3)
RXN-6383 [EC: 4.2.1.116]

Predicted SEED Role

"Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17)" in subsystem Isobutyryl-CoA to Propionyl-CoA Module or Valine degradation (EC 4.2.1.17)

MetaCyc Pathways

• oleate β-oxidation (30/35 steps found)
• adipate degradation (5/5 steps found)
• 2-methyl-branched fatty acid β-oxidation (11/14 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• benzoyl-CoA biosynthesis (3/3 steps found)
• superpathway of coenzyme A biosynthesis II (plants) (8/10 steps found)
• β-alanine biosynthesis II (5/6 steps found)
• valproate β-oxidation (7/9 steps found)
• adipate biosynthesis (4/5 steps found)
• fatty acid β-oxidation IV (unsaturated, even number) (4/5 steps found)
• L-valine degradation I (6/8 steps found)
• fatty acid β-oxidation I (generic) (5/7 steps found)
• acrylate degradation II (2/3 steps found)
• acrylate degradation I (3/5 steps found)
• fatty acid β-oxidation II (plant peroxisome) (3/5 steps found)
• propanoyl-CoA degradation II (3/5 steps found)
• fatty acid β-oxidation VI (mammalian peroxisome) (4/7 steps found)
• methyl ketone biosynthesis (engineered) (3/6 steps found)
• benzoate biosynthesis III (CoA-dependent, non-β-oxidative) (2/5 steps found)
• (8E,10E)-dodeca-8,10-dienol biosynthesis (6/11 steps found)
• superpathway of phenylethylamine degradation (6/11 steps found)
• benzoyl-CoA degradation I (aerobic) (3/7 steps found)
• phenylacetate degradation I (aerobic) (4/9 steps found)
• 3-hydroxypropanoate cycle (6/13 steps found)
• benzoate biosynthesis I (CoA-dependent, β-oxidative) (3/9 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (9/18 steps found)
• 3-phenylpropanoate degradation (3/10 steps found)
• glyoxylate assimilation (5/13 steps found)
• superpathway of the 3-hydroxypropanoate cycle (6/18 steps found)
• (4Z,7Z,10Z,13Z,16Z)-docosapentaenoate biosynthesis (6-desaturase) (2/13 steps found)
• docosahexaenoate biosynthesis III (6-desaturase, mammals) (2/14 steps found)
• Spodoptera littoralis pheromone biosynthesis (4/22 steps found)
• platensimycin biosynthesis (6/26 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Caprolactam degradation
• Fatty acid elongation in mitochondria
• Fatty acid metabolism
• Geraniol degradation
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Tryptophan metabolism
• Valine, leucine and isoleucine degradation
• alpha-Linolenic acid metabolism
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.17

Use Curated BLAST to search for 4.2.1.116 or 4.2.1.17

Sequence Analysis Tools

See A0A166Q8T5 at UniProt or InterPro

Protein Sequence (257 amino acids)

>Pf1N1B4_4788 Enoyl-CoA hydratase [valine degradation] (EC 4.2.1.17) (Pseudomonas fluorescens FW300-N1B4)
MNYETILLETHGRVGLITLNRPQALNALNAQIVSELNHALDGLEADSNIGCIVLTGSKKA
FAAGADIKEMAELTYPQIYLDDLFSDSDRVANRRKPIIAAVNGFALGGGCELALMCDFIL
AGDNAKFGQPEINLGVLPGMGGTQRLTRAVGKAKAMEMCLSGRLIDAVEAERCGIVARIV
PADELVDEALKVAALIAKKSLPIAMMIKESVNRAFEVSLSEGVRFERRVFHAAFATQDQK
EGMAAFIAKREAEFVGK