Protein Info for Pf1N1B4_4755 in Pseudomonas fluorescens FW300-N1B4

Annotation: ribosomal protein S6 glutaminyl transferase related protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 PF14401: RLAN" amino acids 22 to 173 (152 residues), 180 bits, see alignment E=4.7e-57 PF02655: ATP-grasp_3" amino acids 280 to 453 (174 residues), 25.8 bits, see alignment E=2.1e-09 PF08443: RimK" amino acids 282 to 459 (178 residues), 36.1 bits, see alignment E=1.1e-12 PF07478: Dala_Dala_lig_C" amino acids 306 to 458 (153 residues), 35.3 bits, see alignment E=1.8e-12

Best Hits

KEGG orthology group: None (inferred from 94% identity to pfo:Pfl01_2617)

Predicted SEED Role

"ribosomal protein S6 glutaminyl transferase related protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q8A0 at UniProt or InterPro

Protein Sequence (492 amino acids)

>Pf1N1B4_4755 ribosomal protein S6 glutaminyl transferase related protein (Pseudomonas fluorescens FW300-N1B4)
MIIVERKEDWASYFPSEDIVTAQEYLEQTRDNEQGKRVQVINLCRSYKYLGHGYYCSLLA
EARGHKVIPSVRTISELTRKSLYGLALDDLDKTLDKALSNHLYSDTEGFTLTLYFGKTAI
EPLQDLARQLFEVFSCPILLVEFRRTNGWHIEGVKSGALHKLREDQEDQFANALDSFSRK
IWRMPRSRRLARYDLAILHDPQEALPPSNPKALDNFVRVGKTLGIDVELIERKDYARIAE
YDGLLIRETTSVDNHTYRFAKKAESEGLVVMDDPASILRCTNKVYLTDLLKSHQLGMPAT
EILYKERPEDFERVGERLGFPLVLKIPDGCFSKGVIKVESQQALLEATAELFEHSVLLLA
QEFFYTEYDWRIGVLNRKPIFACQYFMSKGHWQIYNHKAKGQDINGECRTLAVHEAPRAV
VELAVKTANLIGDGLYGVDLKQSGDKVVVIEVNDNPNMDAGIEDAYLQDDLYSLVLEEFV
RRLELKRRGQAW