Protein Info for Pf1N1B4_4754 in Pseudomonas fluorescens FW300-N1B4

Annotation: GNAT family acetyltransferase VC2332

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR01575: ribosomal-protein-alanine acetyltransferase" amino acids 13 to 142 (130 residues), 87.3 bits, see alignment E=4.8e-29 PF00583: Acetyltransf_1" amino acids 20 to 125 (106 residues), 60.7 bits, see alignment E=4.1e-20 PF13673: Acetyltransf_10" amino acids 22 to 128 (107 residues), 43.9 bits, see alignment E=5.6e-15 PF13508: Acetyltransf_7" amino acids 42 to 126 (85 residues), 51 bits, see alignment E=3.9e-17 PF11814: DUF3335" amino acids 159 to 361 (203 residues), 291.4 bits, see alignment E=8.3e-91

Best Hits

KEGG orthology group: None (inferred from 85% identity to pfo:Pfl01_2616)

Predicted SEED Role

"GNAT family acetyltransferase VC2332"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q887 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Pf1N1B4_4754 GNAT family acetyltransferase VC2332 (Pseudomonas fluorescens FW300-N1B4)
MNPVFRLAVVEDIPSLLALEQQCFTTDRLNSRSFQWMITRAHGQLLVAQRGEQLVGYAVV
LFHRGTSLARLYSIAIALDARGSGLGKQLLERVEACAIEHDCAYLRLEVRIDNPTAIALY
ERNGYRRFALIHDYYQDHADALRLEKRILQHRDSRNIKVPYYPQTTEFTCGPACLLMAMG
ALQDDRTLERGEELQIWREATTVFMTSGHGGCSPQGLALAAWRRGFRVQLQLSMAGPLFL
DGVRDAHKKDVMRLVHEAFTAQLQATDVERMIGGPLDLPRLLHDGGQPLVLISSYRLTRS
KAPHWVIVTDCDEEFVYLHDPDVDHSQHRQPMDCQHLPVSHGEFDKMCSFGRGKLRAAVI
LYRRE