Protein Info for Pf1N1B4_4751 in Pseudomonas fluorescens FW300-N1B4

Annotation: Ku domain protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details TIGR02772: Ku protein" amino acids 2 to 261 (260 residues), 320 bits, see alignment E=6.1e-100 PF02735: Ku" amino acids 11 to 189 (179 residues), 163.4 bits, see alignment E=3e-52

Best Hits

Swiss-Prot: 73% identical to KU_PSESM: Non-homologous end joining protein Ku (ku) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: K10979, DNA end-binding protein Ku (inferred from 84% identity to pfo:Pfl01_2613)

Predicted SEED Role

"Ku domain protein" in subsystem DNA Repair Base Excision

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161ZER8 at UniProt or InterPro

Protein Sequence (286 amino acids)

>Pf1N1B4_4751 Ku domain protein (Pseudomonas fluorescens FW300-N1B4)
MARAIWKGAISFGLVHIPVALVSATSSHGIDFNWLDSRSMDPVGYKRINKATGKEVTQEH
IVKGIEYEKGRYVVLSEEEIRSAHPLSTQTIDIFAFVGSEQIPLQNIDTPYYLAPDKRGG
KVYALLRETLSKTDKVALARVVLHSRQHLAALMPLESAMVLVMLRWPAEVRSLDQLELGS
EVTKPDLAKGELEMAKRLVEDMSADWTPEEYRDSFEDKIMALVEKKANEGKIEDVETVTG
EEVRKTADVIDLTELLKRSLGGKGSGKPAAKAKTSADKKATKHSRG