Protein Info for Pf1N1B4_4740 in Pseudomonas fluorescens FW300-N1B4

Annotation: Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 544 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 191 to 215 (25 residues), see Phobius details PF08269: dCache_2" amino acids 37 to 186 (150 residues), 145.3 bits, see alignment E=6e-46 PF17200: sCache_2" amino acids 41 to 191 (151 residues), 148.6 bits, see alignment E=3.4e-47 PF17201: Cache_3-Cache_2" amino acids 93 to 185 (93 residues), 42.6 bits, see alignment E=1.2e-14 PF00672: HAMP" amino acids 211 to 263 (53 residues), 50 bits, see alignment 7.4e-17 PF00015: MCPsignal" amino acids 330 to 509 (180 residues), 139 bits, see alignment E=3.7e-44

Best Hits

Swiss-Prot: 71% identical to MCPP_PSEPK: Methyl-accepting chemotaxis protein McpP (mcpP) from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / NCIMB 11950 / KT2440)

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 93% identity to pfo:Pfl01_2601)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z864 at UniProt or InterPro

Protein Sequence (544 amino acids)

>Pf1N1B4_4740 Methyl-accepting chemotaxis protein I (serine chemoreceptor protein) (Pseudomonas fluorescens FW300-N1B4)
MNSLRSVSISRRLWLILIVAVVMLLTLGVLMLKQIHDDLYQAKAQKTQHVVQTASGILTY
YHGLETAGTLTRDAAQKQALTAVRGLRYDQNDYFWINDLTPVMVMHPTNPKLEGQNLSTI
RDPDGFALFNEMVAIAKAKGAGMVDYRWPKPGASAPVEKTSYVKLFEPWGWVIGSGVYID
DMQAEFYAQVWKASFVGLVIALIMALLVIMIARSIVRPLQETVNAMANIASGESDLTRSL
DTHGQDEVTQLARHFNAFTAKLRLVISQLQVSAGALGQSSNELGNDAAQAQQRSQQQSQQ
MELVATAINEVTYGVQDVAKNAEHAASEMRNAESQAQQGQVNIDGSLQQIDKLSSTIDQA
VEVIRTLAAESTQIGSVLEVIRSIAEQTNLLALNAAIEAARAGEQGRGFAVVADEVRLLA
QRTQKSTAEIQSMIERLQSHSEAAVKVIGDSSRASQLTIEQAGLAGASLNAIGQALRNLN
GLNASIASATLQQAHVVEDINQNVTQAAGLSHSTALAAEQSSVASVHLKELSEQLNGLLK
QFRV