Protein Info for Pf1N1B4_4727 in Pseudomonas fluorescens FW300-N1B4

Annotation: HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 TIGR00099: Cof-like hydrolase" amino acids 12 to 266 (255 residues), 176.3 bits, see alignment E=9e-56 TIGR01484: HAD hydrolase, family IIB" amino acids 12 to 239 (228 residues), 104 bits, see alignment E=1.2e-33 PF08282: Hydrolase_3" amino acids 13 to 266 (254 residues), 198.4 bits, see alignment E=1.8e-62 PF05116: S6PP" amino acids 167 to 246 (80 residues), 41.7 bits, see alignment E=1.1e-14

Best Hits

KEGG orthology group: K07024, (no description) (inferred from 88% identity to pfo:Pfl01_2588)

Predicted SEED Role

"HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q7R8 at UniProt or InterPro

Protein Sequence (273 amino acids)

>Pf1N1B4_4727 HMP-PP hydrolase (pyridoxal phosphatase) Cof, detected in genetic screen for thiamin metabolic genes (PMID:15292217) (Pseudomonas fluorescens FW300-N1B4)
MSEITQQPIRFLLSDMDGTLLLPDHSLSQRTIEAVRALREAGVLFSLATGRPPKAMLQQI
EALGVDLPTAAFNGGTLVNPDGSVLVAHYLPATAALTALTLFADQPDIEVWVFSGGDWLL
QDQYGPMVPREQHGLGYPPVVVENFEPYLARIDKIVAASNNAGLLIELEAQLLPKVEGQA
QVSRSQPIYLDVTAMKANKGEALATLAEFLGVPLEQTAAMGDGGNDPAMFHRAGLSIAMG
QAEEAVKRQADVVTGANTEDGAAQAIEQYILPR