Protein Info for Pf1N1B4_4716 in Pseudomonas fluorescens FW300-N1B4

Annotation: Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01547: SBP_bac_1" amino acids 33 to 297 (265 residues), 73 bits, see alignment E=9e-24 PF13531: SBP_bac_11" amino acids 39 to 302 (264 residues), 43 bits, see alignment E=9.4e-15 PF13416: SBP_bac_8" amino acids 41 to 327 (287 residues), 114.5 bits, see alignment E=1.6e-36 PF13343: SBP_bac_6" amino acids 109 to 314 (206 residues), 65.8 bits, see alignment E=8.8e-22

Best Hits

Swiss-Prot: 46% identical to SPUD_PSEAB: Putrescine-binding periplasmic protein SpuD (spuD) from Pseudomonas aeruginosa (strain UCBPP-PA14)

KEGG orthology group: None (inferred from 92% identity to pfo:Pfl01_2575)

MetaCyc: 46% identical to putrescine ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2)" in subsystem Polyamine Metabolism (TC 3.A.1.11.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q7G0 at UniProt or InterPro

Protein Sequence (363 amino acids)

>Pf1N1B4_4716 Putrescine ABC transporter putrescine-binding protein PotF (TC 3.A.1.11.2) (Pseudomonas fluorescens FW300-N1B4)
MAPLFKLCLPALFLAMAVPAQAEEKVLNLYSWADYVAPETLQRFEKETGIHVRYDTFDAP
EVLETKLLTGGSGYDVVVPSSSVLARGLAAGALREISHDGLKGYANLDPDMLEKLAAVDP
GNRYGVPYTWGTLGLGMNVEAVKQRLPNVPLNSLDLLFKPEYASKLKDCGIAILDSPQEV
IGLALHYLGKDPYSTDKADLTAADALLRQLQPSVLYVATGRQINDLANGSVCLALTYNGD
ASMAADQARKANKPFEVAYRIPREGTLVWQDNLAIPKDAPHPEAARAFIEFMLRPESVAA
LTNTLFFATANRAATPLVDEAVRSDPDIYPQSEVRERLYADRSMSLKDMRQRTRLWTTFR
SRQ