Protein Info for Pf1N1B4_4675 in Pseudomonas fluorescens FW300-N1B4

Annotation: Mg(2+) transport ATPase protein C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 transmembrane" amino acids 18 to 35 (18 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details amino acids 73 to 93 (21 residues), see Phobius details amino acids 105 to 124 (20 residues), see Phobius details amino acids 130 to 148 (19 residues), see Phobius details PF02308: MgtC" amino acids 23 to 148 (126 residues), 130.5 bits, see alignment E=2.1e-42

Best Hits

KEGG orthology group: K07507, putative Mg2+ transporter-C (MgtC) family protein (inferred from 88% identity to pba:PSEBR_a1897)

Predicted SEED Role

"Mg(2+) transport ATPase protein C"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q6D7 at UniProt or InterPro

Protein Sequence (157 amino acids)

>Pf1N1B4_4675 Mg(2+) transport ATPase protein C (Pseudomonas fluorescens FW300-N1B4)
VTLQAEFADIGDASQLTRITVRLLMAALLGGILGFEREQKGKAAGIRTHMLVALGAALFV
LVPQMSGSQADAMSRVVQGVIAGIGFLGAGTILKNTDGDEGHVKGLTTAAGLWMTAAIGV
SAGMGREATAVLSTLLALVILGVMPVVVRQLEKDRPP