Protein Info for Pf1N1B4_4633 in Pseudomonas fluorescens FW300-N1B4

Annotation: Exonuclease SbcD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 TIGR00619: exonuclease SbcCD, D subunit" amino acids 5 to 263 (259 residues), 174.5 bits, see alignment E=1.8e-55 PF00149: Metallophos" amino acids 6 to 236 (231 residues), 54.9 bits, see alignment E=1.7e-18 PF12320: SbcD_C" amino acids 289 to 391 (103 residues), 56.3 bits, see alignment E=3.6e-19

Best Hits

KEGG orthology group: K03547, exonuclease SbcD (inferred from 93% identity to pfo:Pfl01_3216)

Predicted SEED Role

"Exonuclease SbcD" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q5J7 at UniProt or InterPro

Protein Sequence (418 amino acids)

>Pf1N1B4_4633 Exonuclease SbcD (Pseudomonas fluorescens FW300-N1B4)
VEYALRLFHTSDWHLGQNLHGQERDFEHACFLDWLLRQLKLDQPDVLLIAGDIFDTVNPP
VKAQERLYDFIVSAHEQQPLLTIVMIAGNHDSGSRIELPAPLMRRLRTHALGRVLWLDDG
QLDAERLLLPLPDASGEIAAWCLALPFLRPAEVTGAHLGDNYLRGIGQVHEWLIEAANAK
RKPGQALIAISHAHMAGGSVSEDSERSLIIGNAEALPASLFGPSISYVALGHLHKPQKVN
GEERIRYCGSPIPLSFSEINYQHQILDIQLDGETLVSVEPRLIPRSVHLQRLGAAPLAEI
LLQLADLPNIDLLADIQRQPWLEVRVRLDEPQPDLRHQVETALQGKAVRLVRIAAEYAGN
GSREGVDDGTTLIELDQLSPQELFSRAWQDNYGSEVDEQTLKDFAELLQDVQMESEQP