Protein Info for Pf1N1B4_4611 in Pseudomonas fluorescens FW300-N1B4

Annotation: GlpG protein (membrane protein of glp regulon)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 88 to 106 (19 residues), see Phobius details amino acids 142 to 165 (24 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details PF16733: NRho" amino acids 1 to 66 (66 residues), 94.9 bits, see alignment E=2.7e-31 PF01694: Rhomboid" amino acids 137 to 279 (143 residues), 106.2 bits, see alignment E=1.7e-34

Best Hits

KEGG orthology group: K02441, GlpG protein (inferred from 86% identity to pfo:Pfl01_2197)

Predicted SEED Role

"GlpG protein (membrane protein of glp regulon)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q524 at UniProt or InterPro

Protein Sequence (290 amino acids)

>Pf1N1B4_4611 GlpG protein (membrane protein of glp regulon) (Pseudomonas fluorescens FW300-N1B4)
MTAVAVLRLPLAVDLSGFVKLLQRMQVPHRVSEEAGEQVLWVPANISEDVRSLYERFPAG
DPDQQLDIPIAQTLQRPGLVEQLRHSKATALVLLLTLIVAMVTLLGDNLDTIRWLTFLDF
RVVGEYIHFTPLADSLAAGQWWRLVTPMLIHFGILHLAMNGMWYWELGRRIESRQGSINL
IGLTLLFSLVSNYVQFLFSGPSLFGGLSGVLYGLLGHCWIFQLLSPNPAYRLPRGVLVMM
LVWLLVCLSGLVSMIGFGQIANAAHVSGLLIGCFTGLLGGLYNRRKLTSK