Protein Info for Pf1N1B4_4524 in Pseudomonas fluorescens FW300-N1B4

Annotation: Sensory box transcriptional regulator, LuxR family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 498 PF13188: PAS_8" amino acids 14 to 55 (42 residues), 28.6 bits, see alignment 2.4e-10 TIGR00229: PAS domain S-box protein" amino acids 140 to 261 (122 residues), 37 bits, see alignment E=1.7e-13 amino acids 263 to 387 (125 residues), 42.8 bits, see alignment E=2.6e-15 PF00989: PAS" amino acids 143 to 243 (101 residues), 24.2 bits, see alignment E=7e-09 amino acids 272 to 377 (106 residues), 23.7 bits, see alignment E=9.9e-09 PF13426: PAS_9" amino acids 157 to 252 (96 residues), 27.9 bits, see alignment E=5.8e-10 amino acids 278 to 379 (102 residues), 33.9 bits, see alignment E=7.8e-12 PF00196: GerE" amino acids 428 to 482 (55 residues), 64.7 bits, see alignment 1.1e-21

Best Hits

KEGG orthology group: None (inferred from 84% identity to pfo:Pfl01_3423)

Predicted SEED Role

"Sensory box transcriptional regulator, LuxR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z7R6 at UniProt or InterPro

Protein Sequence (498 amino acids)

>Pf1N1B4_4524 Sensory box transcriptional regulator, LuxR family (Pseudomonas fluorescens FW300-N1B4)
MSQDVLTTETNRRQLQQIIAGLSDGVILLELDQTILWANDAALTMHGVSRIGELGANAKE
YAKRFALRYRNNHPVATENYPISRVARGEMFNDVLVELTPVENDERTWVHSVRSMVLADR
AGEPESLVLIMNDVTEWASAEQRFEKTFNANPAPAVICRLSDLRYIKVNQGFLEMTGYAR
DQVIGTSTYELDVLERAENKDLAKQRLRDGATIPQMQAELQLPDGGSKQVIVAGQPLELN
DEACILFSFVDMELRHKAEIALRQSEERFAKAFRLTPIPILVCSADDQVVMDVNEAFLDT
LACPSEEVLGKTVAQLGFIDDAGARTRLFAALEKTGSVDRVDVRVRRKDAGLIDCAVSAD
TVNIQGGTCYLLVLMDITERKRTELELVSAIEEVMKDASWFSRTLIEKLANVKNVNSPQL
PTVSFTELTARERDVLGLICEGLADKEIAARLKLAPNTVRNHVSTVYSKLDVHSRSEAIV
WARERGLFSSERRPKGQR