Protein Info for Pf1N1B4_4467 in Pseudomonas fluorescens FW300-N1B4
Annotation: peptidyl-prolyl cis-trans isomerase, FkbP-type
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 54% identical to FKBP_NEIMA: FK506-binding protein (fbp) from Neisseria meningitidis serogroup A / serotype 4A (strain Z2491)
KEGG orthology group: None (inferred from 88% identity to pfv:Psefu_3159)Predicted SEED Role
"peptidyl-prolyl cis-trans isomerase, FkbP-type"
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A166Q207 at UniProt or InterPro
Protein Sequence (112 amino acids)
>Pf1N1B4_4467 peptidyl-prolyl cis-trans isomerase, FkbP-type (Pseudomonas fluorescens FW300-N1B4) MNDELQVIDLEVGDGKAAVKGALITTQYRGWLEDGTEFDSSYSRGKPFQCVIGTGRVIKG WDQGIMGMQVGGKRKLLVPAHLAYGERTMGAITPNSNLIFEIELLEVLTRDD