Protein Info for Pf1N1B4_4441 in Pseudomonas fluorescens FW300-N1B4

Annotation: Cyanate hydratase (EC 4.2.1.104)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF21291: CYNS_N
  • amino acids 13 to 79 (67 residues), 99.6 bits, E=8e-33
• TIGR00673: cyanase
  • amino acids 13 to 155 (143 residues), 188.5 bits, E=3.3e-60
• PF02560: Cyanate_lyase
  • amino acids 87 to 152 (66 residues), 107.3 bits, E=2.8e-35

Best Hits

Swiss-Prot: 76% identical to CYNS_PSEF5: Cyanate hydratase (cynS) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K01725, cyanate lyase [EC: 4.2.1.104] (inferred from 84% identity to pfo:Pfl01_3369)

MetaCyc: 65% identical to cyanase (Escherichia coli K-12 substr. MG1655)
Cyanase. [EC: 4.2.1.104]

Predicted SEED Role

"Cyanate hydratase (EC 4.2.1.104)" in subsystem Cyanate hydrolysis (EC 4.2.1.104)

MetaCyc Pathways

• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• cyanate degradation (3/3 steps found)
• urea degradation I (3/3 steps found)
• superpathway of allantoin degradation in yeast (5/6 steps found)
• cyanuric acid degradation II (3/5 steps found)
• cyanuric acid degradation I (2/5 steps found)
• uracil degradation III (2/5 steps found)
• superpathway of atrazine degradation (3/8 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.104

Sequence Analysis Tools

See A0A161ZCH2 at UniProt or InterPro

Protein Sequence (155 amino acids)

>Pf1N1B4_4441 Cyanate hydratase (EC 4.2.1.104) (Pseudomonas fluorescens FW300-N1B4)
MQQSHAYQDPSLALTTSILDAKARRNLSWQDLTDGTGLGLAYVTAALLGQHPLPEAAAKV
IGEKLELDADAVARLQIIPLRGSLSGIPTDPTIYRFYEMIQIYGTTLKALVHEQFGDGII
SAINFKLDMKKVEDPEGGSRAVITLDGKFLPLRPF