Protein Info for Pf1N1B4_4433 in Pseudomonas fluorescens FW300-N1B4

Annotation: FIG035246: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 171 transmembrane" amino acids 20 to 36 (17 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details PF07681: DoxX" amino acids 25 to 110 (86 residues), 81.6 bits, see alignment E=2.7e-27

Best Hits

KEGG orthology group: None (inferred from 80% identity to pfo:Pfl01_3375)

Predicted SEED Role

"FIG035246: DoxX family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q174 at UniProt or InterPro

Protein Sequence (171 amino acids)

>Pf1N1B4_4433 FIG035246: DoxX family protein (Pseudomonas fluorescens FW300-N1B4)
MNTSLSSALKGLHLNLDRAGSWIAPLTLRVFLAWEFFESGLEKWNGQNWFADIQNRFPFP
FNHIPATLNWELAMWAELICALALLVGLGTRVSAIILTVVTIVATAAVHWPADWSTLSEL
AQGYAISNKGHGNFKLPLIYLAALMPLLLSGAGKLSVDALLARYFWRRSLR