Protein Info for Pf1N1B4_4427 in Pseudomonas fluorescens FW300-N1B4

Annotation: Glutamate transport membrane-spanning protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 transmembrane" amino acids 21 to 39 (19 residues), see Phobius details amino acids 59 to 84 (26 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 133 to 150 (18 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 226 to 248 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 49 to 151 (103 residues), 56.3 bits, see alignment E=1.9e-19 PF00528: BPD_transp_1" amino acids 69 to 259 (191 residues), 54.2 bits, see alignment E=8.1e-19

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 91% identity to pfs:PFLU2235)

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q117 at UniProt or InterPro

Protein Sequence (262 amino acids)

>Pf1N1B4_4427 Glutamate transport membrane-spanning protein (Pseudomonas fluorescens FW300-N1B4)
MAIESSVTAPMAWPRRHVGKLLLLAVAVLWLVYFAPYSPVLKALLQWSPALVVGFGQNIL
ISLVAIGLGSLLGLLVGALGLSPLWLLRLPARIWVQVFRNAPWLVLIYFTTYVFPFEIHI
GSAYVSFPDWVKVTLGLALPASANVAEIFRGAVASIPSTQWEAARSLAFTRGQIFRSIIL
PQCFKRMLPPWMNLYAVITMGTALASLVGVHDVIDTAQIASNTVNLTGFTVVIYLSLLVL
FFAYCYPISRLTQHLERRYAFY