Protein Info for Pf1N1B4_4413 in Pseudomonas fluorescens FW300-N1B4

Annotation: Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 451 transmembrane" amino acids 8 to 27 (20 residues), see Phobius details amino acids 39 to 61 (23 residues), see Phobius details amino acids 73 to 95 (23 residues), see Phobius details amino acids 149 to 167 (19 residues), see Phobius details amino acids 187 to 208 (22 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 306 to 337 (32 residues), see Phobius details amino acids 349 to 373 (25 residues), see Phobius details PF00375: SDF" amino acids 8 to 400 (393 residues), 374.1 bits, see alignment E=4.3e-116

Best Hits

Swiss-Prot: 65% identical to DCTA3_RALSO: C4-dicarboxylate transport protein 3 (dctA3) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03309, dicarboxylate/amino acid:cation (Na+ or H+) symporter, DAACS family (inferred from 91% identity to psp:PSPPH_1577)

MetaCyc: 56% identical to C4 dicarboxylate/orotate:H+ symporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-121; TRANS-RXN-121A; TRANS-RXN-121C; TRANS-RXN-122A; TRANS-RXN0-451; TRANS-RXN0-517; TRANS-RXN0-553

Predicted SEED Role

"Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate" in subsystem Pyruvate metabolism I: anaplerotic reactions, PEP

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q0R1 at UniProt or InterPro

Protein Sequence (451 amino acids)

>Pf1N1B4_4413 Aerobic C4-dicarboxylate transporter for fumarate, L-malate, D-malate, succunate (Pseudomonas fluorescens FW300-N1B4)
MKRIFGKLYVQVLIAVILGAIVGVFVPETGTALKPLGDAFIKLIKMLLAPVIFLTVVTGI
ARMENMKELGRVGFRALIYFEVVSTLALVVGLVVVDVFKPGAGMNIDVASLDTSSLATYT
TAVKHASFMDFVMNIIPDTIVDAFAKGNVLQILLFSILLGVALAHVGPRAKVFVDTLDSL
MQGMFRIVNMVMRLAPIGAFGAIAFTIGKYGFGSLFSLGKLMACVYLTCAVFVIFVLGPI
CRYSGFSLWKFLKFIKEELFTVLGTSSSESVLPQMISKMEKAGVSKPVAGMIIPSGLTFN
PDGQAIYYTIAAIFIAQATNTPLTLTDQLIVLAVLMFTSKGSAGVTGSGFIILAATLSSL
GTIPVAGMVLLLGVDRFMSEARAITNTIGNGVGTMAIAKWVGALDTVKMHKALNGEAAEQ
KPETVQADIVAVPSAMPAKSLLPDFKSVSQG