Protein Info for Pf1N1B4_4408 in Pseudomonas fluorescens FW300-N1B4

Annotation: two-component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 201 PF00072: Response_reg" amino acids 2 to 111 (110 residues), 102.7 bits, see alignment E=2.7e-33 PF06490: FleQ" amino acids 2 to 114 (113 residues), 27.5 bits, see alignment E=6.6e-10 PF08281: Sigma70_r4_2" amino acids 136 to 180 (45 residues), 27.8 bits, see alignment 3.2e-10 PF00196: GerE" amino acids 137 to 192 (56 residues), 75.8 bits, see alignment E=3.1e-25

Best Hits

Swiss-Prot: 58% identical to NODW_BRADU: Nodulation protein W (nodW) from Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110)

KEGG orthology group: None (inferred from 87% identity to pba:PSEBR_a2628)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166Q0M8 at UniProt or InterPro

Protein Sequence (201 amino acids)

>Pf1N1B4_4408 two-component response regulator (Pseudomonas fluorescens FW300-N1B4)
MVFVVDDDASMRNALSNLLRSAGIQVETFASTAEFLQQPKTEGASCLILDVRLQGNSGLE
FQSQLAKSNASIPIVFITGHGDIEMSVKAMKAGAVDFLAKPFREQDLLDAVSAALQADVK
RRQFEQQFSDLHAHYQTLTAREKEVMALAVKGLMNKQIAGQMNLSEITVKIHRGHAMKKM
HAKSFADLVRMAESLGERLDR