Protein Info for Pf1N1B4_4396 in Pseudomonas fluorescens FW300-N1B4

Annotation: Arginine/ornithine ABC transporter, ATP-binding protein AotP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00005: ABC_tran
  • amino acids 19 to 178 (160 residues), 123.2 bits, E=1.3e-39

Best Hits

Swiss-Prot: 86% identical to AOTP_PSEAE: Arginine/ornithine transport ATP-binding protein AotP (aotP) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 88% identity to pfs:PFLU4761)

MetaCyc: 40% identical to L-arginine ABC transporter ATP binding subunit (Escherichia coli K-12 substr. MG1655)
ABC-4-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Arginine/ornithine ABC transporter, ATP-binding protein AotP" in subsystem Arginine and Ornithine Degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

See A0A162AZF4 at UniProt or InterPro

Protein Sequence (254 amino acids)

>Pf1N1B4_4396 Arginine/ornithine ABC transporter, ATP-binding protein AotP (Pseudomonas fluorescens FW300-N1B4)
MYKLEVQDLHKSYGAHQVLKGVSLQAQAGDVISIIGSSGSGKSTFLRCINLLEQPNAGNI
VLNGEPLKLVANKLGGLKAAEPKQLQRMRSQLSMVFQHFNLWSHMSALENVMEAPVHVQG
LGKKEAREKAEHYLDKVGVAHRMNAWPAHMSGGEQQRVAIARALAMEPQVMLFDEPTSAL
DPELVGEVLKVMQDLAQEGRTMVVVTHEMGFAREVSNQLVFLHKGVVEERGDPSEVLVNP
QSERLQQFLSGSLK