Protein Info for Pf1N1B4_4375 in Pseudomonas fluorescens FW300-N1B4

Annotation: Chromate transport protein ChrA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 25 to 45 (21 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 156 to 188 (33 residues), see Phobius details amino acids 231 to 255 (25 residues), see Phobius details amino acids 262 to 285 (24 residues), see Phobius details amino acids 309 to 331 (23 residues), see Phobius details amino acids 337 to 363 (27 residues), see Phobius details amino acids 378 to 402 (25 residues), see Phobius details amino acids 411 to 428 (18 residues), see Phobius details amino acids 434 to 451 (18 residues), see Phobius details PF02417: Chromate_transp" amino acids 23 to 187 (165 residues), 155.9 bits, see alignment E=5.1e-50 amino acids 261 to 446 (186 residues), 121 bits, see alignment E=2.7e-39 TIGR00937: chromate efflux transporter" amino acids 29 to 445 (417 residues), 240.2 bits, see alignment E=2.8e-75

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 84% identity to pba:PSEBR_a1794)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z7E8 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Pf1N1B4_4375 Chromate transport protein ChrA (Pseudomonas fluorescens FW300-N1B4)
LNKAPSSTVDQNLSKPEAISLREAFLFWLKLGFISFGGPAGQISIMHQELVERRRWISER
RFLHALNYCMLLPGPEAQQLATYIGWLMHRTWGGLIAGALFVLPSLFILIALSWLYIAFG
EVPVVAGLFYGIKPAVTAIVVQAAHRIGSRALKNNWLWGIAAASFTAIFVFNVPFPLIVL
GAAIIGYVGGRLAPERFQTGGHGAAKKSFGPALIDDDTPPPEHARFNRFKLLRLLLVGAA
LWVLPMGILTTLFGWEGTLTQMAWFFTKAALLTFGGAYAVLPYVYQGAVGHYGWLTPTQM
IDGLALGETTPGPLIMVVAFVGFVGAYVQQVFGPDHVFLAGALAATLVTWFTFLPSFLFI
LAGGPLVESTHNELRLTAPLTAITAAVVGVILNLACFFGYHVLWPNGFSGQLDWPSTLIA
IAAAIALFRFKRGVIEVLTGCGLIGLVVHLLR