Protein Info for Pf1N1B4_4348 in Pseudomonas fluorescens FW300-N1B4

Annotation: 2'-5' RNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 transmembrane" amino acids 49 to 64 (16 residues), see Phobius details TIGR02258: 2'-5' RNA ligase" amino acids 11 to 169 (159 residues), 89.9 bits, see alignment E=9.6e-30 PF02834: LigT_PEase" amino acids 20 to 94 (75 residues), 40.4 bits, see alignment E=2.8e-14 amino acids 98 to 170 (73 residues), 27.2 bits, see alignment E=3.7e-10 PF13563: 2_5_RNA_ligase2" amino acids 22 to 146 (125 residues), 42.6 bits, see alignment E=6.6e-15

Best Hits

Swiss-Prot: 34% identical to THPR_ECOLI: RNA 2',3'-cyclic phosphodiesterase (thpR) from Escherichia coli (strain K12)

KEGG orthology group: K01975, 2'-5' RNA ligase [EC: 6.5.1.-] (inferred from 74% identity to pfo:Pfl01_2116)

MetaCyc: 34% identical to RNA 2',3'-cyclic phosphodiesterase (Escherichia coli K-12 substr. MG1655)
6.5.1.-; RXN-15952 [EC: 3.1.4.58]

Predicted SEED Role

"2'-5' RNA ligase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.58 or 6.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PZD0 at UniProt or InterPro

Protein Sequence (179 amino acids)

>Pf1N1B4_4348 2'-5' RNA ligase (Pseudomonas fluorescens FW300-N1B4)
MSDESREPFKRLFYALNCAPEQRRAIAQWRSALGLNIGRPVPAENFHLTLLFLGTVGMAQ
IAGVCKAAANVRTSGVPLTVVLDRLDVWRRSGVLLLAPAQAAPELLRLVYALEQAMLPFG
FEDTRREFRPHLTLMRDYRAPVPESATPPEFFLRADRFTLFESHKGRYRALAEWPLVCA