Protein Info for Pf1N1B4_4331 in Pseudomonas fluorescens FW300-N1B4

Annotation: Transporter, LysE family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 37 to 63 (27 residues), see Phobius details amino acids 68 to 90 (23 residues), see Phobius details amino acids 110 to 131 (22 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 179 to 203 (25 residues), see Phobius details PF01810: LysE" amino acids 16 to 201 (186 residues), 74 bits, see alignment E=6e-25

Best Hits

KEGG orthology group: None (inferred from 78% identity to pfl:PFL_2679)

Predicted SEED Role

"Transporter, LysE family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162AZ92 at UniProt or InterPro

Protein Sequence (205 amino acids)

>Pf1N1B4_4331 Transporter, LysE family (Pseudomonas fluorescens FW300-N1B4)
MTLSVLAAFWAVSFLFVITPGADWAYAISAGLFGRVVMPAVAGLLIGHLVATLVVAAGVG
GLVASNPVALSVLTVGGAGYLLWLGINMLVHPSVPRAGQAQESASWARWTFKGLCVSGLN
PKVFLLFLALLPQFTDPTASWPVPMQIIALGLLHAFSCGVIYLLVGFGSRIVLQARPVAA
QVVSRLSGAIMIIIAVLLLIEQILH