Protein Info for Pf1N1B4_4330 in Pseudomonas fluorescens FW300-N1B4

Annotation: 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF02548: Pantoate_transf" amino acids 19 to 275 (257 residues), 352 bits, see alignment E=2e-109 TIGR00222: 3-methyl-2-oxobutanoate hydroxymethyltransferase" amino acids 20 to 280 (261 residues), 289.3 bits, see alignment E=1.5e-90 PF13714: PEP_mutase" amino acids 26 to 216 (191 residues), 38.3 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 71% identical to PANB_NOCSJ: 3-methyl-2-oxobutanoate hydroxymethyltransferase (panB) from Nocardioides sp. (strain ATCC BAA-499 / JS614)

KEGG orthology group: K00606, 3-methyl-2-oxobutanoate hydroxymethyltransferase [EC: 2.1.2.11] (inferred from 83% identity to avn:Avin_46440)

MetaCyc: 43% identical to ketopantoate hydroxymethyltransferase (Arabidopsis thaliana col)
3-methyl-2-oxobutanoate hydroxymethyltransferase. [EC: 2.1.2.11]

Predicted SEED Role

"3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11)" in subsystem Coenzyme A Biosynthesis (EC 2.1.2.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.11

Use Curated BLAST to search for 2.1.2.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PYS4 at UniProt or InterPro

Protein Sequence (280 amino acids)

>Pf1N1B4_4330 3-methyl-2-oxobutanoate hydroxymethyltransferase (EC 2.1.2.11) (Pseudomonas fluorescens FW300-N1B4)
MSDTFSPYGNNEVSNVKSRIRIPHLQQMKVQGQTWAMLTAYDMYTATIFEEAGIPVLLVG
DSASNNVYGHESTLPVTVDELIPLVRAVTRSTRRPLVIADLPFGSYQASAEQCFHTAVRF
MKEGGAHAVKIEGDIEMLPQVEKLTRSGIPVMAHIGFTPQSEHQLGGYRVQGRGDNAQRL
IESARAFEAAGAFALLIEMVPAEVAARITAAVSIPTVGIGAGNGCDAQVLVWQDMAGLRT
GPLPRFVKQYADMRGVLLGAARDFAGDVQAGDFPGDEHSF