Protein Info for Pf1N1B4_4286 in Pseudomonas fluorescens FW300-N1B4

Annotation: Inositol transport system ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 526 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF00005: ABC_tran" amino acids 48 to 198 (151 residues), 113.8 bits, see alignment E=1e-36 amino acids 298 to 451 (154 residues), 82.7 bits, see alignment E=4e-27

Best Hits

Swiss-Prot: 87% identical to RGMG_PSEF5: Putative ribose/galactose/methyl galactoside import ATP-binding protein (PFL_2594) from Pseudomonas fluorescens (strain ATCC BAA-477 / NRRL B-23932 / Pf-5)

KEGG orthology group: K02056, simple sugar transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 94% identity to pba:PSEBR_a3347)

Predicted SEED Role

"Inositol transport system ATP-binding protein" in subsystem Inositol catabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z9H8 at UniProt or InterPro

Protein Sequence (526 amino acids)

>Pf1N1B4_4286 Inositol transport system ATP-binding protein (Pseudomonas fluorescens FW300-N1B4)
MEYLIMFASATASSTPLMGVQPTATPVDEPYLLEIINVSKGFPGVVALSDVQLRVRPGSV
LALMGENGAGKSTLMKIIAGIYQPDAGELRLRGKPVVFETPLAALQAGIAMIHQELNLMP
HMSIAENIWIGREQLNGLHMIDHREMHRCTAKLLERLRINLDPEELVGNLSIAERQMVEI
AKAVSYDSDILIMDEPTSAITDKEVAHLFSIIADLKRQGKGIIYITHKMNEVFSIADEVA
VFRDGAYIGLQRADSMDGDSLISMMVGRELSQLFPVREKPIGDLLLSVRDLKLDGIFKDV
SFDLHAGEILGIAGLMGSGRTNVAEAIFGITPSDGGEIRLDGEVVRISDPHMAIEKGFAL
LTEDRKLSGLFPCLSVLENMEMAVLPHYVGNGFIQQKALRALCEDMCKKLRVKTPSLEQC
IDTLSGGNQQKALLARWLMTNPRILILDEPTRGIDVGAKAEIYRLISYLASEGMAVIMIS
SELPEVLGMSDRVMVMHEGDLMGTLDRSEATQERVMQLASGMSAVH