Protein Info for Pf1N1B4_4276 in Pseudomonas fluorescens FW300-N1B4

Annotation: 5-deoxy-glucuronate isomerase (EC 5.3.1.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04962: KduI
  • amino acids 10 to 266 (257 residues), 336 bits, E=7.8e-105
• TIGR04378: 5-deoxy-glucuronate isomerase
  • amino acids 19 to 266 (248 residues), 314.7 bits, E=2.2e-98

Best Hits

Swiss-Prot: 54% identical to IOLB_BACSK: 5-deoxy-glucuronate isomerase (iolB) from Bacillus clausii (strain KSM-K16)

KEGG orthology group: K03337, 5-deoxy-glucuronate isomerase [EC: 5.3.1.-] (inferred from 90% identity to pba:PSEBR_a3354)

Predicted SEED Role

"5-deoxy-glucuronate isomerase (EC 5.3.1.-)" in subsystem Inositol catabolism (EC 5.3.1.-)

MetaCyc Pathways

• myo-inositol degradation I (6/7 steps found)
• myo-, chiro- and scyllo-inositol degradation (6/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of ansamycins
• Galactose metabolism
• Inositol phosphate metabolism
• Pentose and glucuronate interconversions

Isozymes

Compare fitness of predicted isozymes for: 5.3.1.-

Use Curated BLAST to search for 5.3.1.-

Sequence Analysis Tools

See A0A166PXK4 at UniProt or InterPro

Protein Sequence (269 amino acids)

>Pf1N1B4_4276 5-deoxy-glucuronate isomerase (EC 5.3.1.-) (Pseudomonas fluorescens FW300-N1B4)
MSLLVKSNARGRTMVELGQGALEYVGFAAYRLSLGETLPVSAGDKELCLVLLSGRVSIKG
EAPGQGAFDWDNIGDRQSVFEDKSPFAAYLPPGSQAQVVALSDVQIAVCAAPGSTAENHS
PRLIKPDSMKRSVRGKGANTRYVCDILPDTEPAHSLLVVEVRTPSGHSSSYPPHKHDTDD
LPHQSFLEETYYHQINPPQGFVFQRVYTDDRSIDQAMAVENGDLVVVPKGYHPVSVPYGY
ESYYLNVMAGPKRVWQFHNDPQHSWLLEL