Protein Info for Pf1N1B4_4271 in Pseudomonas fluorescens FW300-N1B4

Annotation: Hydrogen cyanide synthase HcnC / Opine oxidase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 7 to 21 (15 residues), see Phobius details amino acids 47 to 66 (20 residues), see Phobius details PF00890: FAD_binding_2" amino acids 6 to 229 (224 residues), 32 bits, see alignment E=2e-11 PF01266: DAO" amino acids 6 to 384 (379 residues), 243.3 bits, see alignment E=1.5e-75

Best Hits

Swiss-Prot: 87% identical to HCNC_PSEPH: Hydrogen cyanide synthase subunit HcnC (hcnC) from Pseudomonas protegens (strain DSM 19095 / LMG 27888 / CHA0)

KEGG orthology group: K10816, hydrogen cyanide synthase HcnC [EC: 1.4.99.5] (inferred from 90% identity to pfo:Pfl01_3514)

MetaCyc: 87% identical to hydrogen cyanide synthase HcnC subunit (Pseudomonas protegens CHA0)
Glycine dehydrogenase (cyanide-forming). [EC: 1.4.99.5]

Predicted SEED Role

"Hydrogen cyanide synthase HcnC / Opine oxidase subunit B"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.5

Use Curated BLAST to search for 1.4.99.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PXH3 at UniProt or InterPro

Protein Sequence (419 amino acids)

>Pf1N1B4_4271 Hydrogen cyanide synthase HcnC / Opine oxidase subunit B (Pseudomonas fluorescens FW300-N1B4)
MSKFYDVVIAGGGVIGASCAYQLSKRKHLKVALIDAKRPGNATRASAGGLWAIGESVGLG
CGVIFFRMMSANRKREAQGAAVAVDSSTPHILPQAFFDFALQSNAMYPDLHRELQENHGM
DFKFEKTGLKFVIYDDEDRLYAEHIVACIPHLADQVRWLDQAALREAEPSVSHEARGALE
FLCDHQVSPFRLADAYTEGARQNGVDLYFNTNVTGVLHHGSRVSGVQTAEAGVFHCDTLI
NAAGAWAADLSEQATGIRIPVNPVKGQILLTERMPKILHGCLTTSDCYVAQKDNGEILIG
STTEDKGFDVTTTYPEISGLVQGALRCIPALADISLKRCWAGLRPGSPDELPILGPMKGV
EGYLNACGHFRTGILTSAITGVLLDKLVNNEPLPLDITPFLADRFAGGPEVESKGMEMT