Protein Info for Pf1N1B4_4198 in Pseudomonas fluorescens FW300-N1B4

Annotation: 4-hydroxybenzoate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 21 to 46 (26 residues), see Phobius details amino acids 58 to 78 (21 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 147 to 171 (25 residues), see Phobius details amino acids 177 to 198 (22 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 321 to 340 (20 residues), see Phobius details amino acids 346 to 369 (24 residues), see Phobius details amino acids 381 to 404 (24 residues), see Phobius details amino acids 410 to 430 (21 residues), see Phobius details PF07690: MFS_1" amino acids 29 to 338 (310 residues), 141.5 bits, see alignment E=5e-45 amino acids 260 to 428 (169 residues), 48.5 bits, see alignment E=9.6e-17 PF00083: Sugar_tr" amino acids 36 to 251 (216 residues), 77.9 bits, see alignment E=1.2e-25 PF06779: MFS_4" amino acids 45 to 214 (170 residues), 44.8 bits, see alignment E=1.7e-15

Best Hits

Swiss-Prot: 82% identical to GALT_PSEPU: Gallate transporter (galT) from Pseudomonas putida

KEGG orthology group: None (inferred from 83% identity to ppf:Pput_3199)

Predicted SEED Role

"4-hydroxybenzoate transporter" in subsystem Cinnamic Acid Degradation or Gentisare degradation or Phenylpropanoid compound degradation or Salicylate and gentisate catabolism or p-Hydroxybenzoate degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A161Z713 at UniProt or InterPro

Protein Sequence (445 amino acids)

>Pf1N1B4_4198 4-hydroxybenzoate transporter (Pseudomonas fluorescens FW300-N1B4)
MTSETVDIKAWIDNRKVAPYQWLIMGLCFFIVLFDGFDVAVMGFIAPSLIQEWGLSKAVF
GPVMSAGMVGLAIGALTAGPYADRLGRKKVLLTAVTGFSVLSLACAFARNPYELAALRLL
TGVALGAALPNTTTLLSEYLPERNRSLFITIMFTGFNMGSGLGGFLAAWLIPHHGWQSVL
LAGGILPLLLLPLMWLLLPESARFLAARNAPASQIAKVLNKLGGTFSAATKFVIAEPEAQ
QKAPLRLLFTEHYRFGTLALWATYFMGLLVIYLTMGWMPTLLREGGLSIERAATITGLFQ
IGGTVGAIVVGWAMDRRNPNAVIATSYALGGAFILLLGAFSLESSLLAFGVVAAGFCMSG
AQTGLNAFAPGYYPTDCRATGVSWMLGIGRFGAIFGSLIGGAVLSLGLGLPLLFALLSVP
AFIAALAIMANGHARRRVSRALLAH