Protein Info for Pf1N1B4_4134 in Pseudomonas fluorescens FW300-N1B4

Annotation: Na+ driven multidrug efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 452 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 53 to 76 (24 residues), see Phobius details amino acids 89 to 113 (25 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 165 to 187 (23 residues), see Phobius details amino acids 195 to 217 (23 residues), see Phobius details amino acids 243 to 268 (26 residues), see Phobius details amino acids 288 to 310 (23 residues), see Phobius details amino acids 323 to 343 (21 residues), see Phobius details amino acids 362 to 382 (21 residues), see Phobius details amino acids 389 to 409 (21 residues), see Phobius details amino acids 419 to 439 (21 residues), see Phobius details PF01554: MatE" amino acids 20 to 179 (160 residues), 92.1 bits, see alignment E=1.6e-30 amino acids 249 to 410 (162 residues), 103.3 bits, see alignment E=5.7e-34 TIGR00797: MATE efflux family protein" amino acids 20 to 421 (402 residues), 225.4 bits, see alignment E=5.8e-71

Best Hits

Swiss-Prot: 40% identical to YOEA_BACSU: Probable multidrug resistance protein YoeA (yoeA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 85% identity to pfo:Pfl01_3541)

Predicted SEED Role

"Na+ driven multidrug efflux pump"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PTZ7 at UniProt or InterPro

Protein Sequence (452 amino acids)

>Pf1N1B4_4134 Na+ driven multidrug efflux pump (Pseudomonas fluorescens FW300-N1B4)
MQTPTTQHPLWQTYLLFLAPMVLSNFLQSMSGTINSIYIGQMLGTQSLAAVSGMFPVVFF
FIALVIGLGAGAGVLIGQAWGARELHLVKAIAGSTLLLGAMIGLVAAVLGSVFARPALQG
LGTPVDVLDDAVAYAHVMMWILPSLLVFVLFTQLLRGVSDTVSPLLALVVSTCVGLALTP
ALILGWLGLPPMGIQSAAWAGLAGNLAAMVWLAWRLIRKGHPLAPDREMFASMRLDMDIL
GKVLRIGLPTGLQMVVLSLSELVILALVNQHGSQATAAYGAVTQIVNYVQFPALSIAITA
SILGAQAIGAGRIERMGPILRTGLLINVCLTGGLVVLGYLLSHWLLGLFLTDDSTRAMAE
HLLHIMLWSLLVFGFQAIVGGIMRASGTVLVPVVVTIVCVVGVQLPVAYLLDARFGLQGV
WMAFPVAYLGMLMFQTLYYKMVWQHQKIERLV