Protein Info for Pf1N1B4_4123 in Pseudomonas fluorescens FW300-N1B4
Annotation: Isochorismate pyruvate-lyase (EC 4.-.-.-)
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to PCHB_PSEAE: Isochorismate pyruvate lyase (pchB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
KEGG orthology group: None (inferred from 80% identity to pfl:PFL_0353)MetaCyc: 43% identical to isochorismate pyruvate lyase (Pseudomonas aeruginosa)
RXN-1981 [EC: 4.2.99.21]
Predicted SEED Role
"Isochorismate pyruvate-lyase (EC 4.-.-.-)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 4.-.-.-)
MetaCyc Pathways
- salicylate biosynthesis I (1/2 steps found)
KEGG Metabolic Maps
- Biosynthesis of type II polyketide backbone
- Photosynthesis - antenna proteins
- Porphyrin and chlorophyll metabolism
- Vitamin B6 metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.-.-.- or 4.2.99.21
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A161ZBQ1 at UniProt or InterPro
Protein Sequence (106 amino acids)
>Pf1N1B4_4123 Isochorismate pyruvate-lyase (EC 4.-.-.-) (Pseudomonas fluorescens FW300-N1B4) MEVINQLQPAECEGMEDIRREIDALDHAVIKLLGKRFQYVLAASKFKTSATSVRAPERFK AMLATRREWAETEGLSPDAIEKMYSDLVNHFIAEEMKHWAAHQSEN