Protein Info for Pf1N1B4_4123 in Pseudomonas fluorescens FW300-N1B4

Annotation: Isochorismate pyruvate-lyase (EC 4.-.-.-)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01817: CM_2
  • amino acids 19 to 95 (77 residues), 64.1 bits, E=6.4e-22

Best Hits

Swiss-Prot: 43% identical to PCHB_PSEAE: Isochorismate pyruvate lyase (pchB) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: None (inferred from 80% identity to pfl:PFL_0353)

MetaCyc: 43% identical to isochorismate pyruvate lyase (Pseudomonas aeruginosa)
RXN-1981 [EC: 4.2.99.21]

Predicted SEED Role

"Isochorismate pyruvate-lyase (EC 4.-.-.-)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 4.-.-.-)

MetaCyc Pathways

• salicylate biosynthesis I (1/2 steps found)

KEGG Metabolic Maps

• Biosynthesis of type II polyketide backbone
• Photosynthesis - antenna proteins
• Porphyrin and chlorophyll metabolism
• Vitamin B6 metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.-.-.- or 4.2.99.21

Sequence Analysis Tools

See A0A161ZBQ1 at UniProt or InterPro

Protein Sequence (106 amino acids)

>Pf1N1B4_4123 Isochorismate pyruvate-lyase (EC 4.-.-.-) (Pseudomonas fluorescens FW300-N1B4)
MEVINQLQPAECEGMEDIRREIDALDHAVIKLLGKRFQYVLAASKFKTSATSVRAPERFK
AMLATRREWAETEGLSPDAIEKMYSDLVNHFIAEEMKHWAAHQSEN