Protein Info for Pf1N1B4_4115 in Pseudomonas fluorescens FW300-N1B4

Annotation: FIG074102: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 159 PF04073: tRNA_edit" amino acids 30 to 146 (117 residues), 88.1 bits, see alignment E=2.5e-29

Best Hits

Swiss-Prot: 47% identical to YEAK_ECO57: Uncharacterized protein YeaK (yeaK) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 76% identity to pfl:PFL_5205)

MetaCyc: 47% identical to mischarged aminoacyl-tRNA deacylase (Escherichia coli K-12 substr. MG1655)
3.1.1.-; 3.1.1.-; 3.1.1.-; 3.1.1.-; 3.1.1.-; 3.1.1.-; 3.1.1.-

Predicted SEED Role

"FIG074102: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QJC1 at UniProt or InterPro

Protein Sequence (159 amino acids)

>Pf1N1B4_4115 FIG074102: hypothetical protein (Pseudomonas fluorescens FW300-N1B4)
MHPMFDRLVALLDARAASYRVLMHDAEGQSARVAEIRGTEPGQGAKAMLCSLKGQAEPYA
LVILPGDQKLDMKKVGAALGGKKAELVKAETAMELTGCRIGAIPPFVFDERIQLIVDPAL
TTGYSEIAFNAGRLDASMVLDTQDYLAIAKPRLLDISQA