Protein Info for Pf1N1B4_4107 in Pseudomonas fluorescens FW300-N1B4

Annotation: Probable glutathione S-transferase (EC 2.5.1.18), YfcF homolog

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 15 to 80 (66 residues), 53 bits, E=7.3e-18
• PF13409: GST_N_2
  • amino acids 15 to 81 (67 residues), 53.3 bits, E=6.9e-18
• PF13417: GST_N_3
  • amino acids 15 to 85 (71 residues), 52.2 bits, E=1.2e-17
• PF14834: GST_C_4
  • amino acids 93 to 205 (113 residues), 155 bits, E=2.1e-49

Best Hits

Swiss-Prot: 53% identical to YFCF_ECOLI: Glutathione S-transferase YfcF (yfcF) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 80% identity to pfo:Pfl01_2422)

MetaCyc: 53% identical to glutathione S-transferase YfcF (Escherichia coli K-12 substr. MG1655)
Glutathione transferase. [EC: 2.5.1.18]

Predicted SEED Role

"Probable glutathione S-transferase (EC 2.5.1.18), YfcF homolog" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 2.5.1.18

Sequence Analysis Tools

See A0A162AYR0 at UniProt or InterPro

Protein Sequence (210 amino acids)

>Pf1N1B4_4107 Probable glutathione S-transferase (EC 2.5.1.18), YfcF homolog (Pseudomonas fluorescens FW300-N1B4)
VNDSRLRLYVDAQFTSPYAMSVFVALREKGIEFELSPLDLDAFENQAENYASLSLTQRVP
TLVHGDFALSESSAIIEYLEDVFPQAPVYPQELRQRARARQIQAWLRSDLLPIRQERSTL
VVFYGLKSAPLSPAAESATRKLIDAAQALLADGREYLFGQWSIADVDLALMLNRLILNGD
VVPSALVEYAQRQWQRPTVQEWVKLQRPAL