Protein Info for Pf1N1B4_4071 in Pseudomonas fluorescens FW300-N1B4

Annotation: tRNA 5-methylaminomethyl-2-thiouridine synthase TusD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 140 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details PF02635: DsrE" amino acids 11 to 137 (127 residues), 73.3 bits, see alignment E=1e-24 TIGR03012: sulfur relay protein TusD/DsrE" amino acids 12 to 137 (126 residues), 149.8 bits, see alignment E=1.7e-48

Best Hits

Swiss-Prot: 72% identical to TUSD_PSEAE: Sulfurtransferase TusD homolog (tusD) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K07235, tRNA 2-thiouridine synthesizing protein D [EC: 2.8.1.-] (inferred from 90% identity to pfo:Pfl01_3575)

MetaCyc: 46% identical to DsrE (Allochromatium vinosum)

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusD"

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166QJA0 at UniProt or InterPro

Protein Sequence (140 amino acids)

>Pf1N1B4_4071 tRNA 5-methylaminomethyl-2-thiouridine synthase TusD (Pseudomonas fluorescens FW300-N1B4)
MAAVSLIEPIMKFAIALFSAAHAPSSRRALLFAQAALAGGHEIVRLFFYQDGVYNASASV
VTPQDEQDLPKQWRNFVTEHQLDGVVCIAAALRRGVLNEEEAQRYQREAVAVGAPWELSG
LGQLHDAVQDADRLICFGGT