Protein Info for Pf1N1B4_4019 in Pseudomonas fluorescens FW300-N1B4

Annotation: Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 73 to 384 (312 residues), 173.7 bits, see alignment E=2.5e-55 PF16576: HlyD_D23" amino acids 87 to 312 (226 residues), 138.7 bits, see alignment E=2.6e-44 PF13533: Biotin_lipoyl_2" amino acids 101 to 140 (40 residues), 32.1 bits, see alignment 1.1e-11 PF13437: HlyD_3" amino acids 210 to 309 (100 residues), 70.9 bits, see alignment E=2.1e-23

Best Hits

KEGG orthology group: None (inferred from 90% identity to pfo:Pfl01_3622)

MetaCyc: 66% identical to cobalt-zinc-cadmium resistance protein (Pseudomonas putida KT2440)
RXN1G01-61; TRANS-RXN0-200; TRANS-RXN0-244

Predicted SEED Role

"Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PR12 at UniProt or InterPro

Protein Sequence (397 amino acids)

>Pf1N1B4_4019 Cobalt/zinc/cadmium efflux RND transporter, membrane fusion protein, CzcB family (Pseudomonas fluorescens FW300-N1B4)
MEKKLIIVAAATLALGLGIGSMRPGNASIDAHADEAAEHADHAEEGAAAEGEHAEEGRLE
LSAEQIAAAGIQLTEARAQNISLGLPFPGEVRFDEDRTAHVVPRVPGVVESVSVNLGQSV
KKGQLLAVIASQQISDQRSEQAAAQRRLTLARTTYEREKKLWQDKISAEQDFLLARQALE
EAEIALANARQKISVLSGSVVATGGNRYELRAPFDGVVVEKHLTPGEVVDETTNAFTLSD
LSRVWVTFGVSPKDLTKVQVGKPVTVSAPELNAEVAGTVAYVGSLLGEQTRTATVRVTLE
NPQGAWRPGLFVTALVATDSRQAKVAVPETAIQTVEDKPTVFVRTDDGFKAQPVELGSRA
AGLVEVTQGLESGVQVASAGSFVLKSELGKASAEHSH