Protein Info for Pf1N1B4_4009 in Pseudomonas fluorescens FW300-N1B4

Annotation: Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 PF00005: ABC_tran" amino acids 33 to 168 (136 residues), 79.6 bits, see alignment E=5.2e-26 PF17912: OB_MalK" amino acids 242 to 290 (49 residues), 32 bits, see alignment 2.8e-11 PF08402: TOBE_2" amino acids 285 to 354 (70 residues), 27.2 bits, see alignment E=5.1e-10

Best Hits

Swiss-Prot: 41% identical to SUGC_MYCTO: Trehalose import ATP-binding protein SugC (sugC) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 91% identity to pba:PSEBR_a3768)

MetaCyc: 41% identical to ABC-type trehalose transporter ATP-binding protein (Mycobacterium tuberculosis H37Rv)
7.5.2.-

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PQH3 at UniProt or InterPro

Protein Sequence (365 amino acids)

>Pf1N1B4_4009 Glycerol-3-phosphate ABC transporter, ATP-binding protein UgpC (TC 3.A.1.1.3) (Pseudomonas fluorescens FW300-N1B4)
MAEIRLQNLAHSYTSTPTGPEDYAIREMDHVWEQGGAYALLGPSGCGKSTLLNIISGLLS
PSQGQVLFDSKVVNELTPEKRNIAQVFQFPVVYDTMTVFDNLAFPLRNQGMAEAKIHTKV
HEIAEVLDLQALLYKKARNLTADEKQKVSMGRGLVRDDVSAILFDEPLTVIDPHLKWKLR
RKLKQIHEQFNITMVYVTHDQLEASTFADKIAVMYGGQIVQFGTPRELFERPSHTFVGYF
IGSPGMNLIEVQPQAGGVGFTGTHLPLSDAMQKRIAESEWKTLKVGIRPEFVHVWDEPCD
DAMQAQVVHVEDLGTYKIMTLNLDGAPLKVRLAEDKPVPEGTAYISFPAQWLMVYADDYL
LEVLP