Protein Info for Pf1N1B4_4003 in Pseudomonas fluorescens FW300-N1B4

Annotation: UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF00149: Metallophos" amino acids 2 to 198 (197 residues), 39.1 bits, see alignment E=1.2e-13 TIGR01854: UDP-2,3-diacylglucosamine diphosphatase" amino acids 3 to 231 (229 residues), 345.1 bits, see alignment E=7.6e-108

Best Hits

Swiss-Prot: 94% identical to LPXH_PSEPF: UDP-2,3-diacylglucosamine hydrolase (lpxH) from Pseudomonas fluorescens (strain Pf0-1)

KEGG orthology group: K03269, UDP-2,3-diacylglucosamine hydrolase [EC: 3.6.1.-] (inferred from 94% identity to pfo:Pfl01_3641)

MetaCyc: 45% identical to UDP-2,3-diacylglucosamine diphosphatase (Escherichia coli K-12 substr. MG1655)
LIPIDXSYNTHESIS-RXN [EC: 3.6.1.54]

Predicted SEED Role

"UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54)" (EC 3.6.1.54)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.6.1.-

Use Curated BLAST to search for 3.6.1.- or 3.6.1.54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A166PQD4 at UniProt or InterPro

Protein Sequence (250 amino acids)

>Pf1N1B4_4003 UDP-2,3-diacylglucosamine diphosphatase (EC 3.6.1.54) (Pseudomonas fluorescens FW300-N1B4)
VILLISDLHLEEERPDITRAFLDLLARRARSASALYILGDFFEAWIGDDAMTPFQRSICQ
ALRDLSDSGTAIFLMHGNRDFMLGQAFCKQAGCTLLKDPSVVQFYGEPVLLMHGDSLCTR
DEAYMKLRRYLRNPITRFILRNLPLRTRHKLARKLRSESRAQTRMKANDIVDVTPEEVPR
VMQQYGVKTLIHGHTHRPAIHKLQIGEQAAKRIVLGDWDRQGWALQVDENGFALAPFDFA
PPPQLAAPSA