Protein Info for Pf1N1B4_4001 in Pseudomonas fluorescens FW300-N1B4

Annotation: Membrane fusion component of tripartite multidrug resistance system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 63 to 111 (49 residues), 28.8 bits, see alignment 1.7e-10 PF16576: HlyD_D23" amino acids 65 to 293 (229 residues), 52 bits, see alignment E=1.2e-17 PF00529: CusB_dom_1" amino acids 200 to 347 (148 residues), 36.3 bits, see alignment E=8.7e-13 PF13437: HlyD_3" amino acids 219 to 298 (80 residues), 55.4 bits, see alignment E=1.8e-18

Best Hits

Swiss-Prot: 40% identical to EMRA_HAEIN: Multidrug export protein EmrA (emrA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 91% identity to pfo:Pfl01_3643)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A162AYJ0 at UniProt or InterPro

Protein Sequence (400 amino acids)

>Pf1N1B4_4001 Membrane fusion component of tripartite multidrug resistance system (Pseudomonas fluorescens FW300-N1B4)
MATVDTSQAPDNAQDTSNLRKRKVMLFALTIVVILAGLGVWGYQEFYGRWNESTDDAYVN
GNVVEITPLVTGTVVSIGADDGDLVHEGQVLVNFDPNDAEVGLQSAQANLARTVRQVRGL
YSNVDGMKAQVNAQQAEVQKAQDNFNRRKNLAAGGAISQEELSHARDDLTSAQNALANAK
QQLMTTSALVDDTVVSSHPDVMSAAAQLRQAYLTHARSTLIAPVTGYVAKRSVQLGQRVQ
PGTALMAVIPLDQLWIDANFKETQLRDMRIGQPVDIEADLYGSDVKYSGTIDSLGAGTGS
AFALLPAQNATGNWIKIVQRVPVRIHINAEELARHPLRVGLSTQVDVNLRDQSGPVLAQQ
SPQKASFSTSIYDRQLAEADAMITQLIHDNSAAVSKTAQR